SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017069 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017069
Domain Number 1 Region: 12-359
Classification Level Classification E-value
Superfamily UROD/MetE-like 2.62e-107
Family Uroporphyrinogen decarboxylase, UROD 0.0000000000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017069   Gene: ENSMMUG00000016623   Transcript: ENSMMUT00000018232
Sequence length 363
Comment pep:known_by_projection chromosome:MMUL_1:1:47941266:47944481:1 gene:ENSMMUG00000016623 transcript:ENSMMUT00000018232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLER
LRDPAVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQGQRW
LYQRPQAKSKTFFFLITGFIGQAVSGIEALQLFESHAGHLGPQLFNKFALPYIRDVAKRV
KARLREAGLAPVPMIIFAKDGHFALEELSQAGYEVVGLDWTVAPKKARECVGKTVTLQGN
LDPCALYASEEEIGQLVKQMLDDFGPQRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLL
RQN
Download sequence
Identical sequences 9544.ENSMMUP00000017069 ENSMMUP00000017069 ENSMMUP00000017069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]