SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017150 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017150
Domain Number 1 Region: 153-279
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-39
Family FKBP immunophilin/proline isomerase 0.00031
Further Details:      
 
Domain Number 2 Region: 42-158
Classification Level Classification E-value
Superfamily FKBP-like 1.2e-37
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 3 Region: 260-376
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-36
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 
Domain Number 4 Region: 390-487
Classification Level Classification E-value
Superfamily FKBP-like 9.43e-31
Family FKBP immunophilin/proline isomerase 0.00051
Further Details:      
 
Domain Number 5 Region: 495-568
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000312
Family Calmodulin-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017150   Gene: ENSMMUG00000013054   Transcript: ENSMMUT00000018319
Sequence length 582
Comment pep:known chromosome:MMUL_1:16:51908275:51918380:1 gene:ENSMMUG00000013054 transcript:ENSMMUT00000018319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQ
MGDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVP
PHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYH
YNGTLLDGTSFDTSYSKGGTYDTYVGSGWLIKGMDQGLLGMCPGERRKIIIPPFLAYGEK
GYGTVIPPHASLVFHILLIDVHNPKDTVQLETLELPAGCVRRAVAGDFMRYHYNGSLMDG
TLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACIGERRRITIPPHLAYGENGTGDKIPG
SAVLIFNVHVIDFHNPADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSH
DYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEV
ELVSREDGLPTGYLFVWHEDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPG
QDPEKTIGDMFQNQDRNQDGKITVEELKLKSDEDQERVHEEL
Download sequence
Identical sequences A0A2K5IZ32 A0A2K6C7F0 F7H5Q0
ENSMMUP00000017150 NP_001247480.1.72884 XP_005584254.1.63531 XP_011723456.1.29376 XP_011785143.1.43180 XP_011902025.1.92194 ENSMMUP00000017150 9544.ENSMMUP00000017150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]