SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017152 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017152
Domain Number 1 Region: 38-188
Classification Level Classification E-value
Superfamily FKBP-like 1.59e-44
Family FKBP immunophilin/proline isomerase 0.00031
Further Details:      
 
Domain Number 2 Region: 167-271
Classification Level Classification E-value
Superfamily FKBP-like 1.96e-30
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017152   Gene: ENSMMUG00000013054   Transcript: ENSMMUT00000018321
Sequence length 379
Comment pep:known chromosome:MMUL_1:16:51908316:51918380:1 gene:ENSMMUG00000013054 transcript:ENSMMUT00000018321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSSRGTTSPGPVPGKCRWGILCATTTTALSKMARSLTQAGLIPPDATLYFDVVLLDVWN
KEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGTLLDGTSFDTSYSKGGTYDTYVGSGWLI
KGMDQGLLGMCPGERRKIIIPPFLAYGEKGYGTVIPPHASLVFHILLIDVHNPKDTVQLE
TLELPAGCVRRAVAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQ
GACIGERRRITIPPHLAYGENGTGRGVPQPPPQLLLQTAHCGQAAPSHSGIPATTQPLSS
QKHACSLHLVAPSDSCHPDSHQFPPGQRPTSPLLQWRRAANSSEFGEGGWLWKNRTSIPP
GPSCAGSLSVLTCIMGKPS
Download sequence
Identical sequences ENSMMUP00000017152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]