SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017228 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017228
Domain Number 1 Region: 49-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000305
Family V set domains (antibody variable domain-like) 0.042
Further Details:      
 
Domain Number 2 Region: 274-364
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000653
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017228
Domain Number - Region: 172-204
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0262
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017228   Gene: ENSMMUG00000013116   Transcript: ENSMMUT00000018398
Sequence length 413
Comment pep:novel chromosome:MMUL_1:16:54997581:54998819:1 gene:ENSMMUG00000013116 transcript:ENSMMUT00000018398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLALTTVLLWAWGGLQAFEIVEKENIFQKTPCPAFLMFENAAYLADMSFELPCHCKPEE
VPAVVWFYQKHLGSSHTKVLTDFDGRVLTEAAQVRVGSDMLARFSIRMFSLLVFRAQPED
SGLYFCGTRKGDYFYAYDVDIQNSEGMVATFQDEGQEPFADEYYGHLHVFTTFWEWTPCD
RCGVRGEQWRIGLCYLQSPDLSPRYLKAVPDVVSCGSRAVPRKLQTKARDHTPELLVRSC
IVPCEKTKTIREGVLAIVNYVSKVGSRPWVPQVPIQFHQQRLGHGLIISCPGARPEHAVA
WDKDRQHLYRTQYLKGVNRSMRVFIDHGNQLHIRFTQLDDRGIYYCWRQGVRVAGFRLGV
TSRGRYPASLSDPETRSAVELTLIGYLFITAVFVAIHLCRCCCYLFQCCPNFS
Download sequence
Identical sequences ENSMMUP00000017228 ENSMMUP00000017228 9544.ENSMMUP00000017228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]