SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017256 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017256
Domain Number 1 Region: 245-303
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 98-159
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 61-113
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000639
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017256   Gene: ENSMMUG00000013135   Transcript: ENSMMUT00000018429
Sequence length 448
Comment pep:known chromosome:MMUL_1:X:35924131:35998159:-1 gene:ENSMMUG00000013135 transcript:ENSMMUT00000018429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLAMESPAHRPALLLLLPPLLLLLLRVPPSRGFPDTPWCSPIKVKYGDVYCRAPQGGY
YKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDG
AYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNK
LTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRVK
VRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPT
CAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHITV
VELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKERYVSLVMPV
ALFNLIDTFPLRKEEMVLQAEMGQTCNT
Download sequence
Identical sequences A0A2K6D4H5 G7NT00
XP_001083979.1.72884 XP_005593348.1.63531 XP_011708550.1.29376 ENSMMUP00000017256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]