SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017258 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017258
Domain Number 1 Region: 260-318
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 113-174
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 76-128
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000667
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017258   Gene: ENSMMUG00000013135   Transcript: ENSMMUT00000018431
Sequence length 463
Comment pep:known chromosome:MMUL_1:X:35924138:35998044:-1 gene:ENSMMUG00000013135 transcript:ENSMMUT00000018431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPAHRPALLLLLPPLLLLLLRVPPSRGFPGSGDSPLEDDEVGYSHPRYKDTPWCSPIK
VKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCP
TLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPR
IKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTV
YDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSPA
RVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLGM
LQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVDK
HGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMGQTCNT
Download sequence
Identical sequences I2CXR2
ENSMMUP00000017258 ENSMMUP00000017258 9544.ENSMMUP00000017258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]