SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017341 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017341
Domain Number 1 Region: 53-454
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.37e-91
Family L-arabinose binding protein-like 0.00053
Further Details:      
 
Domain Number 2 Region: 870-1061
Classification Level Classification E-value
Superfamily Nucleotide cyclase 8.16e-61
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000488
Further Details:      
 
Domain Number 3 Region: 560-853
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.74e-54
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017341   Gene: ENSMMUG00000013199   Transcript: ENSMMUT00000018517
Sequence length 1108
Comment pep:known_by_projection chromosome:MMUL_1:X:108113290:108219855:-1 gene:ENSMMUG00000013199 transcript:ENSMMUT00000018517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGLWRFSRLVLWFAAFRKLLGHHGLASSKFLWCLCLLVVMYLPQQVWTLPYKIGVVGP
WACDSLFSKALPEVAARLAIERINRDPSFDLSYSFEYVILNEDCQTSRALSSFISHHQMA
SGFIGPTNPGYCEAASLLGNSWDKGIFSWACVNYELDNKNSYPTFSRTLPSPIRVLVTVM
KYFQWAHAGVISSDEDIWVHTANRVASALRSHGLPVGVVLTTGQDSQSIRKALQRIHQAD
RIRIIIMCMHSALIGGETQTHLLEWAHDLKMTDGTYVFVPYDALLYSLPYKHTPYQVLRN
NPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIA
QAMNNAMKENGQAGAASLVQHSRNMQFYGFNQLIRTDSNGNGISEYVILDTNWKEWELHS
TYTVDMEMELLRFGGIPIHFPGGRPPRADAKCWFAEGKICHGGIDAAFAMMVCLTLLIAL
LFINGFAYFIRRRINKIQLIKGPNRILLTLEDVTFINPHFGSKRGSRASVSFQITSEVQS
GRFPRLSFSSGSLTPATYENSNIAIYEGDWVWLKKLPHGDFGDVKSIKSRASDVFEMMKD
LRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKY
LHHREFVHGRLKSRNCVVDGRFVLKVTDYGFNDILEMLRLSEGESCVEELLWTAPELLRT
PRGGRLGSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAQEIINRLKKPPPVYRPVVPPEHA
PPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIR
ERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMS
EPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDI
LSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPY
RIHVSLSTVTILQNLSEGYEMELRGRTELKGKGTEETFWLIGKKGFTKPLPVPPPVDKDG
QVGHGLQPVEIAAFQRRKAERQLVRNKP
Download sequence
Identical sequences XP_014983495.1.72884 ENSMMUP00000017341 ENSMMUP00000017341 9544.ENSMMUP00000017341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]