SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017501 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017501
Domain Number 1 Region: 242-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.05e-20
Family Complement control module/SCR domain 0.00000333
Further Details:      
 
Domain Number 2 Region: 61-127
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.48e-16
Family Complement control module/SCR domain 0.0000323
Further Details:      
 
Domain Number 3 Region: 183-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000111
Family Complement control module/SCR domain 0.00002
Further Details:      
 
Domain Number 4 Region: 118-192
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000848
Family Complement control module/SCR domain 0.0000332
Further Details:      
 
Domain Number 5 Region: 1-71
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000108
Family Complement control module/SCR domain 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017501   Gene: ENSMMUG00000013308   Transcript: ENSMMUT00000018681
Sequence length 323
Comment pep:known chromosome:MMUL_1:1:18594593:18595666:1 gene:ENSMMUG00000013308 transcript:ENSMMUT00000018681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPKPDDLPFSIVVPLKTFYEPGEEITYSCKPGYVSRGGMRRFICPLTGMWPINTLKCTPR
VCPFAGILENGAVRYTTFEYPNTINFSCNTGFYLNGANSAKCTEEGQWSPGIPVCAPITC
PPPSVPMFATLRVYKPSAGNNSFYQDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECRE
VKCPFPLRPDNGFVNYPAKPVLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKA
SCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEV
PKCFKEHSSLAFWKTDASDVKPC
Download sequence
Identical sequences ENSMMUP00000017501 ENSMMUP00000017501 9544.ENSMMUP00000017501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]