SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017702 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017702
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily CoA-transferase family III (CaiB/BaiF) 1.57e-52
Family CoA-transferase family III (CaiB/BaiF) 0.0000258
Further Details:      
 
Domain Number 2 Region: 199-260
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0000000000393
Family L-aspartase/fumarase 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017702   Gene: ENSMMUG00000013467   Transcript: ENSMMUT00000018901
Sequence length 275
Comment pep:known chromosome:MMUL_1:6:34104727:34115526:-1 gene:ENSMMUG00000013467 transcript:ENSMMUT00000018901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQGILVLELAGLAPGPFCAMVLADFGARVVRVERPGSHYDVSRLGRGKRSLALDLKQP
RGAAVLRRLCARSDVLLEPFRSGVMEKLQLGPEILQRDNPRLIYARLTGFGQSGSFSRLA
GHDINYLALSGGRNSIFKFFSVENSEIKSVGSTSRTEHIGWWSTFLYDLQDSRWGIHGCW
SNRTPVLRAADQRSGRTDLAENATGSSIVPGEANPTQCEAMTIVAAQVMGYGVAVTVGGS
SGHIELDVCKPMMIKNLVLHSGCWGMLQFPSQKTA
Download sequence
Identical sequences ENSMMUP00000017702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]