SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017807 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017807
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.46e-59
Family Ran-binding protein mog1p 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017807   Gene: ENSMMUG00000013540   Transcript: ENSMMUT00000019011
Sequence length 186
Comment pep:known_by_projection chromosome:MMUL_1:16:8035869:8037436:1 gene:ENSMMUG00000013540 transcript:ENSMMUT00000019011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPMRDCPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVQG
EAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGCCQEAWVLSGKQQIAKENQQVAK
DVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPPHWSLGDFEQLVTSLTLHDP
NIFGPQ
Download sequence
Identical sequences ENSMMUP00000017807 ENSMMUP00000017807 NP_001181499.1.72884 9544.ENSMMUP00000017807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]