SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017883 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017883
Domain Number 1 Region: 63-135
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.21e-18
Family Complement control module/SCR domain 0.0000228
Further Details:      
 
Domain Number 2 Region: 124-192
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-17
Family Complement control module/SCR domain 0.000017
Further Details:      
 
Domain Number 3 Region: 379-447
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-16
Family Complement control module/SCR domain 0.00064
Further Details:      
 
Domain Number 4 Region: 257-319
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000175
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 199-262
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000418
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 2-73
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000528
Family Complement control module/SCR domain 0.0000281
Further Details:      
 
Domain Number 7 Region: 453-519
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000598
Family Complement control module/SCR domain 0.000025
Further Details:      
 
Domain Number 8 Region: 313-374
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000202
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Domain Number 9 Region: 508-544
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000272
Family Complement control module/SCR domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017883   Gene: ENSMMUG00000013596   Transcript: ENSMMUT00000019093
Sequence length 544
Comment pep:known chromosome:MMUL_1:1:162801727:162825593:-1 gene:ENSMMUG00000013596 transcript:ENSMMUT00000019093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHCKAPDHFPFAKLKTQTIASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCK
RKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECVISGNTAHWSKKPPI
CQRIPCGLPPAIANGDFISTNREYFHYGSVVTYRCNLGSGRKKLFELVGEPSIYCTSKDG
QVGIWSGPAPQCIIPNKCTPPNVENGILVSVNRSLFSLNEVVEFRCQPGFVMKGPRRVQC
QALNKWEPELPSCSRVCQSPPDVLHGERTQRDKDIFQPGQEVFYICEPGYDLRGAASLRC
TPQGDWSPAAPRCEVKSCDDSLGQLPNGRVLFPRSLQLGAKVDFVCDEGKYQPGTVAHAC
NPSTFGRSWRPAWPTWRKIFCPSPPVIPNGRHTGKPLEVFPFGKAVTYTCDPHPDRGMTF
DLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCNAPDHFLFAKLKTQTNASDFPIGTSLK
YECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYS
CTTG
Download sequence
Identical sequences ENSMMUP00000017883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]