SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017886 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017886
Domain Number 1 Region: 1006-1078
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-19
Family Complement control module/SCR domain 0.00021
Further Details:      
 
Domain Number 2 Region: 103-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-18
Family Complement control module/SCR domain 0.00013
Further Details:      
 
Domain Number 3 Region: 164-232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-17
Family Complement control module/SCR domain 0.0000179
Further Details:      
 
Domain Number 4 Region: 553-625
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.43e-17
Family Complement control module/SCR domain 0.0000207
Further Details:      
 
Domain Number 5 Region: 614-682
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.59e-17
Family Complement control module/SCR domain 0.000017
Further Details:      
 
Domain Number 6 Region: 1067-1135
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-16
Family Complement control module/SCR domain 0.000068
Further Details:      
 
Domain Number 7 Region: 419-487
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000121
Family Complement control module/SCR domain 0.00064
Further Details:      
 
Domain Number 8 Region: 747-809
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000361
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 9 Region: 869-938
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000542
Family Complement control module/SCR domain 0.00088
Further Details:      
 
Domain Number 10 Region: 297-359
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 11 Region: 689-752
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000709
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 12 Region: 362-430
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000403
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 13 Region: 813-880
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000445
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 14 Region: 239-302
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000987
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 15 Region: 493-559
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000148
Family Complement control module/SCR domain 0.000025
Further Details:      
 
Domain Number 16 Region: 43-108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000256
Family Complement control module/SCR domain 0.0003
Further Details:      
 
Domain Number 17 Region: 945-1016
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000823
Family Complement control module/SCR domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017886   Gene: ENSMMUG00000013596   Transcript: ENSMMUT00000019096
Sequence length 1150
Comment pep:known chromosome:MMUL_1:1:162762359:162862076:-1 gene:ENSMMUG00000013596 transcript:ENSMMUT00000019096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASSPRSPEPVGPPAPRLPFCCGGSLLAVVVLLALPVAWGQCNAPEQLPFARPTELIDE
SEFSIGTHLKYECRPGYYGRPFSIICLKNSVWTSAEDKCIRKSCRNPRDPVNGMVHVIKD
IQFGSQINYSCTEGYRLIGSSSATCIISDNTLIWDNETPICEKISCGLPPTIDNGDFFSA
NKEYFHYGSVVTYHCNLGSGGRKVFELVGEPSIYCTSNEDQVGIWSGPAPQCIIPNKCTP
PNVENGILVSVKRRLFSLNEVAEFRCQPGFVMKGPRHVQCQALNKWEPELPSCSRVCQSP
PDVLHGERTQRDKDIFQPGQEVFYICEPGYDLRGAASLRCTPQGDWSPAAPRCEVKSCDD
SLGQLPNGRVLFPRSLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIF
CPSPPVIPNGRHTGKPLEVFPFGKAVTYTCDPHPDRGMTFDLIGESTIRCTSDPQGNGVW
SSPAPRCGILGHCNAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNL
VWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECVISGN
TAHWSTKPPICQRIPCGLPPAIANGDFISTNREYFHYGSVVTYRCNLGSGRKKLFELVGE
PSIYCTSKDGQVGIWSGPAPQCIIPNKCTPPNVENGILVSVNRSLFSLNEVVEFRCQPGF
VMKGPRRVQCQALNKWEPELPSCSRVCQPPPEILHGEHTPSHQDKFSPGQEVFYSCEPGY
DLRGAASLHCTPQGDWSPEAPRCAVKSCDDFLGQLHHGRVLVPFNLQLGAKVSFVCDEGF
RLKGSSVSHCVLVGMRSLWNNSVPVCEHIFCPNPPAILNGRHTGALLGDIPYGKEISYTC
DPHPDRGMTFNLIGESTIRCTSDPQGNGVWSSPAPRCELSVRAGHCKTPEQFPFASPTIP
INDFEFPVGTSLNYECHPGYFGRMFSISCLENLVWSSVEDNCRRKSCGTPPEPFNGMVHI
NTDTQFGSTVNYSCNEGFRLIGSPSTTCLVSGNNVTWDKEAPICEIISCKPPPTISNGDF
YSNNRTSFHSGTVVTYQCHTGPDGEQLFELVGERSIYCTSKDDQVGVWSSPPPRCISTNK
CTAPEVENGI
Download sequence
Identical sequences ENSMMUP00000017886 9544.ENSMMUP00000017886 ENSMMUP00000017884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]