SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017890 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017890
Domain Number 1 Region: 51-119
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-17
Family Complement control module/SCR domain 0.000017
Further Details:      
 
Domain Number 2 Region: 307-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-16
Family Complement control module/SCR domain 0.00012
Further Details:      
 
Domain Number 3 Region: 368-437
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.03e-16
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 4 Region: 5-62
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000621
Family Complement control module/SCR domain 0.00053
Further Details:      
 
Domain Number 5 Region: 183-247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000648
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 126-188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000403
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 250-317
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000499
Family Complement control module/SCR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017890   Gene: ENSMMUG00000013596   Transcript: ENSMMUT00000019100
Sequence length 467
Comment pep:known chromosome:MMUL_1:1:162639924:162851707:-1 gene:ENSMMUG00000013596 transcript:ENSMMUT00000019100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHVIKDIQFGSQINYSCTEGYRLIGSSSATCIISDNTLIWDNETPICERIPCGLPPAIA
NGDFISTNREYFHYGSVVTYRCNLGSGRKKLFELVGEPSIYCTSKDGQVGIWSGPAPQCI
IPNKCTPPNVENGILVSVNRSLFSLNEVVEFRCQPGFVMKGPRRVQCQALNKWEPELPSC
SRVCQLPPDVLHGEHTQRDKDNFWPGQEVFYICEPGYDLRGAASLRCTPQGDWSPAAPRC
EVKSCDDFLGQLLNGRVLFPLNFQLGAKVDFVCDEGFRLKGSSASYCVLAGMESLWNSSV
PVCERKSCKTPPDPVNGTVHVITDIQVGSRINYSCTTGFRLKGRFASHCVLAGMKALWNS
SVPVCEQIFCPNPPAILNGRHIGAPLGDIPYGKEVSYTCDPHPDRGMTFNLIGESTIRCT
SDPQGNGVWSSPAPRCELSVPAGANDALIVGTLSGTIFVILFIIFLS
Download sequence
Identical sequences ENSMMUP00000017890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]