SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017895 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017895
Domain Number 1 Region: 526-595
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-19
Family Complement control module/SCR domain 0.00026
Further Details:      
 
Domain Number 2 Region: 275-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.1e-16
Family Complement control module/SCR domain 0.00055
Further Details:      
 
Domain Number 3 Region: 718-780
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.2e-16
Family Complement control module/SCR domain 0.00049
Further Details:      
 
Domain Number 4 Region: 350-420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000115
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 5 Region: 154-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 6 Region: 852-916
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 7 Region: 410-473
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 601-666
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.00065
Further Details:      
 
Domain Number 9 Region: 21-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000189
Family Complement control module/SCR domain 0.0000384
Further Details:      
 
Domain Number 10 Region: 906-970
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 11 Region: 787-846
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000514
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 12 Region: 215-286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000594
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 13 Region: 88-150
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000695
Family Complement control module/SCR domain 0.0000348
Further Details:      
 
Domain Number 14 Region: 682-729
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000139
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 15 Region: 492-537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000737
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017895   Gene: ENSMMUG00000013602   Transcript: ENSMMUT00000019105
Sequence length 995
Comment pep:known_by_projection chromosome:MMUL_1:1:162868199:162906946:-1 gene:ENSMMUG00000013602 transcript:ENSMMUT00000019105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAGLLGVFLALIVPGVLGISCGSPPPILNGRISHYSTPITLGTVIRYICSNGFRLIGE
KNIICITKDKVVGIWDKPAPKCEYFNKYSTCPEPIVPGGYKARGAEPPYIHGDFVTFACK
TNFSMNGNKSVWCQANNKWGPTRLPTCESVFPLECPALPMIHNGHHTRENVGSIAPGLSV
TYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKPLGRFPNGKVKEPPILQVGVTAN
FFCDEGYQLQGPSSSRCVIAGQGVAWTKMPVCKEIFCPSPPPILNGRHTGNSLANVSYGS
IVTYTCDPDPEEGVNFILIGENTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPRPQVLRG
RIVSGQKDRYTYNDTVIFACTFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNG
QKEDRHMVRFNPGTSIKYSCNPGYVLVREESIQCTSEGVWTPPVPQCKVAVCEATGKQLL
TKPQHQFIRPDVNSSCDEGYKLSGSVYQECQGRTPWFMEIRLCKEITCPPPPVIYNGAHT
GSSLEDFPYGTTVTYTCNPGPEREVEFSLIGESTIRCTSNDQERGTWSGPAPLCELSLLA
VQCSHVHVANGYKISGKEAPYFYNDTVTFKCFNGFTLKGSSQIRCKANNTWDPEIPVCEK
ETCQPVREDLQELPVGSRVELVNTSCQDGYWLTGHTYHKCKDDENGIWFKKIPLCKVIHC
HPPPVIVNGKHTGMKAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHGSWSGPSPQC
LQSPPVTSCPNPEVKHGYKLNKTLSAYSHDDIVYVDCHPGFIMNGSRVIRCHTDNTWVPG
VPTCIKKAFVGCQPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGT
WNRPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSSQSQCQADH
QWNPPLAVCRSRSLAPVLSGIAAGLILLIFLIVVY
Download sequence
Identical sequences ENSMMUP00000017895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]