SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017943 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017943
Domain Number 1 Region: 13-40,89-166
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.2e-25
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 150-224
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.23e-16
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017943   Gene: ENSMMUG00000013648   Transcript: ENSMMUT00000019160
Sequence length 257
Comment pep:known_by_projection chromosome:MMUL_1:4:39150819:39158209:-1 gene:ENSMMUG00000013648 transcript:ENSMMUT00000019160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNAGLCSCWGGRVLPLLLVYVCYLLLGATIFQLLERQAEAQSRYHFQLEKLRFLENYTC
LDQWALEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNHLGMGLRAHLATIERWEDRPRRSKVLQVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGHPLNFITPLGSCLLKSLSK
HPLGSQRASRSQDPSRK
Download sequence
Identical sequences ENSMMUP00000017943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]