SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018010 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000018010
Domain Number - Region: 94-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000166
Family I set domains 0.064
Further Details:      
 
Domain Number - Region: 298-339
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0683
Family TNF receptor-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018010   Gene: ENSMMUG00000013690   Transcript: ENSMMUT00000019229
Sequence length 351
Comment pep:known_by_projection chromosome:MMUL_1:3:76307083:76454137:1 gene:ENSMMUG00000013690 transcript:ENSMMUT00000019229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASALGPARRGRRRTRAAGSLLSRAAILLFISAFLVRVPSSVGHLVRLPRGFRLTKDSV
KIVGSTHFPVKVYVMLHQKSPHVLCVTQRLRNAELIDPSFQWHGPKGKIVSVENRTAQIT
STGSLVFQNFEESMSGIYTCFLEYKPTVEEIVKRLQLKYAIYAYREPHYYYQFTARYHAA
PCNSIYNISFEKKLIQILSKLLLDLSCEISLLKSECHHVKMQRAGLQNELFFTFSVSSLD
TEKGPKPCTDHNCEPSKRLFKAKNLIERFFNQQVEILGRRAEQLPEIYYIEGTLQMVWIN
RCFPGYGMNVQQHPKCPECCVICSPGSYNPRDGIHCLQCNSSLVYGAKTCL
Download sequence
Identical sequences G7P1S4
XP_001082779.1.72884 XP_005549667.1.63531 ENSMMUP00000018010 ENSMMUP00000018010 9544.ENSMMUP00000018010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]