SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018022 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018022
Domain Number 1 Region: 4-84
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-29
Family C-type lectin domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018022   Gene: ENSMMUG00000013706   Transcript: ENSMMUT00000019244
Sequence length 84
Comment pep:known_by_projection chromosome:MMUL_1:11:8625518:8626676:-1 gene:ENSMMUG00000013706 transcript:ENSMMUT00000019244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSVKNCCPSNWEYFQSSCYFFSTDTIPWTSSLKNCSAMGAHLVIINSQEEQEFLAYKKPK
MKEFFIGLSDKVVEGQWHWVDGTP
Download sequence
Identical sequences ENSMMUP00000018022 9544.ENSMMUP00000018022 ENSMMUP00000018022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]