SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018063 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018063
Domain Number 1 Region: 113-185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-16
Family Complement control module/SCR domain 0.00037
Further Details:      
 
Domain Number 2 Region: 174-237
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000114
Family Complement control module/SCR domain 0.00024
Further Details:      
 
Domain Number 3 Region: 235-300
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000108
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 427-489
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 484-542
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000431
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 50-118
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000054
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 300-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000202
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 8 Region: 387-431
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000473
Family Complement control module/SCR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018063   Gene: ENSMMUG00000013738   Transcript: ENSMMUT00000019290
Sequence length 598
Comment pep:known_by_projection chromosome:MMUL_1:1:163210992:163251709:-1 gene:ENSMMUG00000013738 transcript:ENSMMUT00000019290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPSRTPSGALHRKGKMAAWPFSRLWKVSDPILFQMTLVAALLPAILGNCDPPPTLSFAA
PVNITTLTETHFETGTTLKYTCRPGYARSHSDQMLTCNSDGQWTYTTFCVHKRCSNPGDL
PNGHVEIKTDLLFGSEIEFSCSEGFVLIGSTTSHCEVQDRGVGWSHPLPQCEIVKCEPPP
DIRNGRHSGEEDFYTYGFSVTYSCDSRFSLLGHASISCTVENKTTGVWRPSPPTCEKITC
HKPDVSHGEIVSGFGPIYNYKDAIVFNCQKGFALTGSSVIRCGADSKWDPSPPACEPSSC
TNLPDIPHASWETYPRPKKEDVYVVGTILRYRCHPGYKPTTDAPTTLICQKNLRWTPYQG
CEALCCPEPKLDSAQITQHRKNRPANHCVYFYGDEISFSCHGIRRFSATCQADGTWSPRT
PSCGDNCNFPPKIAHGHYKQASVYSFFKEEIIYECDKGYVLVGQATLSCSNSRWSAPAPR
CKALCLKPELVNGRLSVDKNQYVEPENVTVQCDSGYGIVGPKSITCSENRTWYPEVPRCE
WETPEGCEQVLAGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDRARQSTLDKEL
Download sequence
Identical sequences 9544.ENSMMUP00000018063 ENSMMUP00000018063 ENSMMUP00000018063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]