SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018103 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018103
Domain Number 1 Region: 189-422
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.2e-59
Family Voltage-gated potassium channels 0.00086
Further Details:      
 
Domain Number 2 Region: 35-144
Classification Level Classification E-value
Superfamily POZ domain 4.45e-31
Family Tetramerization domain of potassium channels 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018103   Gene: ENSMMUG00000013770   Transcript: ENSMMUT00000019332
Sequence length 910
Comment pep:known chromosome:MMUL_1:8:75046890:75428147:1 gene:ENSMMUG00000013770 transcript:ENSMMUT00000019332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKAPPGLNRKTSRSTLSLPPEPVDIIRSKTCSRRVKINVGGLNHEVLWRTLDRLPRTR
LGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFG
QELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPDKRKKLW
DLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQETDEFGQLNDNRQLAHVEAVC
IAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVV
QIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDE
DATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNF
SEFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFARSMELIDVAVEKAGESANTKD
SADDNHLSPSRWKWARKALSETSSNRSFENKYQEVSQKDSHEQLNNTSSSSPQHLSAQKL
EMLYNEITKTQPHSHPNTDCQEKPERPSAYEEEIEMEEVVCPQEQLAVAQTEVIVDMKST
SSIDSFTSCATDFTETERSPLPPPSASHLQMKFPTDLPGTEEHQRARGPPFLTLSREKGP
AARDGMLEYAPVDITVNLDASGSQCGLHSPLQSDNATDSPKSSLKGSKPLKSRSLKVNFK
ENRGSAPQTPPSTARPLPVTAADFSFTTPQHISTILLEETPSQGDRPLLGAEVSAPCQGP
SKGLSPRFPKQKLFPFSSRERRSFTEIDTGEDEDFLELPGAREEKQGDSSPNCFADKPSD
GRDPLREEGSVDSSSLQDTGHNCRQDIYHAMSEVKKDSQEGCKMENHLFAPEIHSNPGDT
GYCPTRETSM
Download sequence
Identical sequences A0A2K5X219 F6Q7Z0
XP_001083422.1.72884 XP_005563584.1.63531 ENSMMUP00000018103 ENSMMUP00000018103 9544.ENSMMUP00000018103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]