SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018299 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018299
Domain Number 1 Region: 56-146
Classification Level Classification E-value
Superfamily Immunoglobulin 5.71e-16
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018299   Gene: ENSMMUG00000013920   Transcript: ENSMMUT00000019541
Sequence length 260
Comment pep:known chromosome:MMUL_1:4:40981763:40986454:-1 gene:ENSMMUG00000013920 transcript:ENSMMUT00000019541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDPLFSAVQGKDKILHKALCICPWPGKGGMEPLRLLILLFATELSGAHNTTVFQGVEGQ
SLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRRNGSTAITDDTLG
GTLTITLRNLQPHDAGFYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWVPGESESF
EDAHVEHSISRSLLEGEIPFPPTSVLLLLACIFLIKILAASALWAAAWHGQKPGTHPPSE
PDCGHDPGHQLQTLPGLRDT
Download sequence
Identical sequences XP_001117305.2.72884 XP_015304909.1.63531 9544.ENSMMUP00000018299 ENSMMUP00000018299 ENSMMUP00000033715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]