SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018306 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018306
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 1.2e-45
Family Eukaryotic RPB5 N-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 135-190
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 1.44e-19
Family RPB5 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018306   Gene: ENSMMUG00000013927   Transcript: ENSMMUT00000019549
Sequence length 190
Comment pep:known_by_projection chromosome:MMUL_1:19:836831:841899:-1 gene:ENSMMUG00000013927 transcript:ENSMMUT00000019549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDEEDTYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQV
Download sequence
Identical sequences ENSMMUP00000018306 9544.ENSMMUP00000018306 ENSMMUP00000018306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]