SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018353 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018353
Domain Number 1 Region: 44-189
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 5.49e-40
Family Isochorismatase-like hydrolases 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018353   Gene: ENSMMUG00000013965   Transcript: ENSMMUT00000019600
Sequence length 200
Comment pep:known_by_projection chromosome:MMUL_1:6:125491091:125510923:1 gene:ENSMMUG00000013965 transcript:ENSMMUT00000019600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRKFVVQLFAEEWGQYVDLPKGFAVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCCDMQ
ERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLVLPKT
KFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGVEVHIVADATSSRSMM
DRMFALEFASCSNRDHSDHE
Download sequence
Identical sequences 9544.ENSMMUP00000018353 ENSMMUP00000018353 ENSMMUP00000018353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]