SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018376 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018376
Domain Number 1 Region: 654-681
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000958
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018376   Gene: ENSMMUG00000013981   Transcript: ENSMMUT00000019625
Sequence length 683
Comment pep:known_by_projection chromosome:MMUL_1:X:28708041:28735936:-1 gene:ENSMMUG00000013981 transcript:ENSMMUT00000019625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHS
PDDNRMNRNRLLHINLGVHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICL
VQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPP
PPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSSS
GRQTPQNTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSAYHSPPPSQC
PSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPHSYQKQGSHPGTAINRSPSPISN
QPSPRNQHSLYTATTPPSSSPSRGISSQPKPPFSVNPVYITYTQPTGPSCTPSPSPRVIP
NPTTVFKITVGRATTENLLNLVDQEERSAAPEPIQPISVIPGSGGEKGSHKYQRSSSSGS
DDYAYTQALLLHQRARMERLAKQLKLEKEELERLKSEVNGMEHDLMQRRLRRVSCTTAIP
TPEEMTRLRSMNRQLQINVDCTLKEVDLLQSRGNFDPKAMNNFYDNIEPGPIVPPKPSKK
DSSDPCTIERKARRISVTSKVQADIHDTHAAAADEHRTGSTQSPRTQPRDEDYEGAPWNC
DSCTFLNHPALNRCEQCEMPRYT
Download sequence
Identical sequences ENSMMUP00000018376 9544.ENSMMUP00000018376 ENSMMUP00000018376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]