SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018564 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018564
Domain Number 1 Region: 50-305
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-97
Family Protein kinases, catalytic subunit 0.00001
Further Details:      
 
Domain Number 2 Region: 613-724
Classification Level Classification E-value
Superfamily KA1-like 3.76e-46
Family Kinase associated domain 1, KA1 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018564   Gene: ENSMMUG00000014131   Transcript: ENSMMUT00000019830
Sequence length 724
Comment pep:known_by_projection chromosome:MMUL_1:14:10535171:10612334:-1 gene:ENSMMUG00000014131 transcript:ENSMMUT00000019830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSARTPLPTLNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIG
KGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIE
TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAEN
LLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL
YTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMK
DRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLL
LGYKSSELEGDTITLKPRPSADLTNSSAPSPSHKVQRSVSANPKQRRFSDQAGPAIPTSN
SYSKKTQSNNAENKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTN
RSRNSPLLERASLGQASIQNGKDSTAPQRVPVASPSAHNISSSGGAPDRTNFPRGVSSRS
TFHAGQLRQVRDQQNLPYGVTPASPSGHSQGRRGASGSIFSKFTSKFVRRNLNEPESKDR
VETLRPHVEGSGVNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQ
SELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIAN
ELKL
Download sequence
Identical sequences ENSMMUP00000018564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]