SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018567 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018567
Domain Number 1 Region: 2-429
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-128
Family ALDH-like 0.0000000000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018567   Gene: ENSMMUG00000014130   Transcript: ENSMMUT00000019833
Sequence length 508
Comment pep:known_by_projection chromosome:MMUL_1:16:19163261:19190943:1 gene:ENSMMUG00000014130 transcript:ENSMMUT00000019833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREVQRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILAAIAADLCKSELNAYSQE
VITVLGEIDFMLENLPEWVTAKPVKKNLLTMMDEAYIQPQPLGVVLIIGAWNYPFVLIIQ
PLIGAIAAGNAVIIKPSELSENTAKIVAKLLPQYLDQDLYVVINGGVEETTELLKQRFDH
IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQSQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
ALGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPVLPIVPVKNVDEAIDFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLRRFNKEKLGLLVFTFLGIVAAVLV
KKYQAVLRRKALLIFLVVHRLRWSSKQR
Download sequence
Identical sequences F7C1D1
9544.ENSMMUP00000018567 ENSMMUP00000018565 XP_014974280.1.72884 XP_014974282.1.72884 ENSMMUP00000018567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]