SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018581 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018581
Domain Number 1 Region: 570-629
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000128
Family Complement control module/SCR domain 0.0000374
Further Details:      
 
Domain Number 2 Region: 394-449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000607
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 334-391
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000144
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 512-567
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000315
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 5 Region: 213-277
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000629
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 6 Region: 266-329
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000115
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 7 Region: 95-155
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000734
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 8 Region: 159-217
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000756
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 9 Region: 30-97
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000419
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018581
Domain Number - Region: 468-522
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00205
Family Complement control module/SCR domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018581   Gene: ENSMMUG00000014139   Transcript: ENSMMUT00000019847
Sequence length 629
Comment pep:known scaffold:MMUL_1:1099214737533:381:28435:-1 gene:ENSMMUG00000014139 transcript:ENSMMUT00000019847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRISNMLLLINVILTLWVSRANGQVQVRPCHFPDIKHGGLYYESMRRPYFPVPVGKYFSY
HCDEHFETPSGSYWDYIHCTQDGWSPAVPCLRKCYFPYLENGYNENNGRKFVQGNSIEVA
CHPGYGLPNEQTTVNCTENGWSPPPRCIRVKTCSKSNIDIENGFISESQYIYALNKQAKY
QCKLGYITADGETSGSITCRKNGWSAQPTCIKSCDMPVFKNARAKSSITWFKLNDILDYE
CHDGYESNTGSTTSSIVCGDNGWSDLPVCYERECELPKIDVHLVPDPKKDEYKVGEVLKF
SCKPGFTRVGPNSVQCYYFGLSPDLPICKEQVQSCGPPPELLNGNIKVKTKEGYGHSEVV
EYYCNPKFLMKGPNKIQCVDGAWTALPVCIEEESTCGDIPELEHGYSELSSPPYYYGDSV
EFTCSESFTMIGHRSITCIHGVWTQLPQCVATDQLKKCNSSNLIVIEGNLTNKKEFNHNS
NIRYRCRGKKEHIHTVCINGKWDPEVTCSKIQLCPPPPQIPNSWTMTTTLNYRDGEKVSV
LCQENYLIQEGEEMTCKDGRWQSIPRCVEKIPCTQPPHVEHGSIISSRSSQENYAHGTKL
SYTCEDGFRLSEENEITCYMGKWSSPPHC
Download sequence
Identical sequences ENSMMUP00000018581 9544.ENSMMUP00000018581 ENSMMUP00000018581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]