SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018582 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018582
Domain Number 1 Region: 503-562
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000011
Family Complement control module/SCR domain 0.0000374
Further Details:      
 
Domain Number 2 Region: 325-380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000526
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 265-322
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000127
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 445-500
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000262
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 5 Region: 144-208
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000511
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 6 Region: 197-260
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000097
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 7 Region: 26-86
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000485
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 8 Region: 90-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000648
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018582
Domain Number - Region: 401-439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00324
Family Complement control module/SCR domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018582   Gene: ENSMMUG00000014139   Transcript: ENSMMUT00000019848
Sequence length 562
Comment pep:known scaffold:MMUL_1:1099214737533:381:23250:-1 gene:ENSMMUG00000014139 transcript:ENSMMUT00000019848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSYLTLIYASHLLYLSLLWSLGKCYFPYLENGYNENNGRKFVQGNSIEVACHPGYGLPN
EQTTVNCTENGWSPPPRCIRLETCSKSNIDIENGFISESQYIYALNKQAKYQCKLGYITA
DGETSGSITCRKNGWSAQPTCIKSCDMPVFKNARAKSSITWFKLNDILDYECHDGYESNT
GSTTSSIVCGDNGWSDLPVCYERECELPKIDVHLVPDPKKDEYKVGEVLKFSCKPGFTRV
GPNSVQCYYFGLSPDLPICKEQVQSCGPPPELLNGNIKVKTKEGYGHSEVVEYYCNPKFL
MKGPNKIQCVDGAWTALPVCIEEESTCGDIPELEHGYSELSSPPYYYGDSVEFTCSESFT
MIGHRSITCIHGVWTQLPQCVATDQLKKCNSSNLIVIEGNLTNKKEFNHNSNIRYRCRGK
KEHIHTVCINGKWDPEVTCSMAQIQLCPPPPQIPNSWTMTTTLNYRDGEKVSVLCQENYL
IQEGEEMTCKDGRWQSIPRCVEKIPCTQPPHVEHGSIISSRSSQENYAHGTKLSYTCEDG
FRLSEENEITCYMGKWSSPPHC
Download sequence
Identical sequences ENSMMUP00000018582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]