SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018615 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018615
Domain Number 1 Region: 571-634
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000987
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 499-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000109
Family TSP-1 type 1 repeat 0.00069
Further Details:      
 
Domain Number 3 Region: 626-682
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000108
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018615
Domain Number - Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000115
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number - Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018615   Gene: ENSMMUG00000014171   Transcript: ENSMMUT00000019887
Sequence length 843
Comment pep:known chromosome:MMUL_1:6:40755153:40838636:1 gene:ENSMMUG00000014171 transcript:ENSMMUT00000019887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAISLFILVGFIGEFQTFSSASSPVNCQWDSYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFLRSSSSSSHSYSSQTN
EIHKRKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THFLQSGSLGGEYRVLFYVDSEKLKQNDFGSVEEKKCKSSGWSFIIKFSSHGCKELEKAL
KASSGTQNNVLRGDPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTDLPEVIKQK
LTPLYELVKEVPCASVKKLYLKRALEEYLDEFDPCHCRPCQNGGLATVAGTHCLCHCKPY
TFGVACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRTCIGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTKFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSTFLCGSSLKWSPEMKNTRCVQKDNPLTQAVPECQRWEKLQNSRCVCKMPYE
CGPSLDVCARDERSKRILPVTVCKMHVLHCQSRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
ETQ
Download sequence
Identical sequences 9544.ENSMMUP00000018615 ENSMMUP00000018615 ENSMMUP00000018615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]