SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018642 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018642
Domain Number 1 Region: 24-125
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.31e-50
Family SWIB/MDM2 domain 0.00000381
Further Details:      
 
Domain Number 2 Region: 140-234
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 2.81e-24
Family SWIB/MDM2 domain 0.028
Further Details:      
 
Domain Number 3 Region: 241-285
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 8.04e-20
Family Ran binding protein zinc finger-like 0.0000507
Further Details:      
 
Domain Number 4 Region: 388-436
Classification Level Classification E-value
Superfamily RING/U-box 0.000000648
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018642   Gene: ENSMMUG00000014193   Transcript: ENSMMUT00000019916
Sequence length 442
Comment pep:known chromosome:MMUL_1:11:65798355:65828515:1 gene:ENSMMUG00000014193 transcript:ENSMMUT00000019916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL
FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
ENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVS
EHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEAQELSDEDDEVYRVTVYQAGESDTD
SFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLEN
STQAEEGFDVPDCKKTIVNDSKESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQE
DVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLK
KRNKPCPVCRQPIQMIVLTYFP
Download sequence
Identical sequences A0A2I3M3L8 A0A2K5P820 A0A2K5W2G2 A0A2K6A880 A0A2K6DKW6 A0A2K6KDJ3 F7AKW0
XP_011831988.1.47321 XP_017731692.1.44346 ENSMMUP00000018642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]