SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018643 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018643
Domain Number 1 Region: 25-113
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 4.58e-29
Family SWIB/MDM2 domain 0.00072
Further Details:      
 
Domain Number 2 Region: 120-164
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 6.8e-20
Family Ran binding protein zinc finger-like 0.0000507
Further Details:      
 
Domain Number 3 Region: 267-315
Classification Level Classification E-value
Superfamily RING/U-box 0.000000347
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018643   Gene: ENSMMUG00000014193   Transcript: ENSMMUT00000019917
Sequence length 321
Comment pep:known chromosome:MMUL_1:11:65799094:65828497:1 gene:ENSMMUG00000014193 transcript:ENSMMUT00000019917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEDLDAGVSE
HSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEAQELSDEDDEVYRVTVYQAGESDTDS
FEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENS
TQAEEGFDVPDCKKTIVNDSKESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQED
VKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKK
RNKPCPVCRQPIQMIVLTYFP
Download sequence
Identical sequences A0A2I3LZK7 A0A2K5P819 A0A2K5W2M6 A0A2K6A869 A0A2K6DL34 A0A2K6KDW2 F7AKU4
XP_011831989.1.47321 ENSMMUP00000018643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]