SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018646 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018646
Domain Number 1 Region: 18-120
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 5.36e-51
Family SWIB/MDM2 domain 0.00000381
Further Details:      
 
Domain Number 2 Region: 189-283
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 3.4e-24
Family SWIB/MDM2 domain 0.028
Further Details:      
 
Domain Number 3 Region: 290-334
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 9.42e-20
Family Ran binding protein zinc finger-like 0.0000507
Further Details:      
 
Domain Number 4 Region: 437-485
Classification Level Classification E-value
Superfamily RING/U-box 0.000000765
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018646   Gene: ENSMMUG00000014193   Transcript: ENSMMUT00000019920
Sequence length 491
Comment pep:known chromosome:MMUL_1:11:65798355:65828515:1 gene:ENSMMUG00000014193 transcript:ENSMMUT00000019920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEAQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSKESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
Download sequence
Identical sequences A0A2I3M6Q4 G7N7L5 G7PI02
XP_005571557.1.63531 XP_011725514.1.29376 XP_011947196.1.92194 XP_011947197.1.92194 XP_015007663.1.72884 XP_015007664.1.72884 XP_015286670.1.63531 XP_017731690.1.44346 XP_017731691.1.44346 ENSMMUP00000018646 ENSMMUP00000018642 9544.ENSMMUP00000018646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]