SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018648 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018648
Domain Number 1 Region: 44-86
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 1.22e-18
Family Ran binding protein zinc finger-like 0.00013
Further Details:      
 
Domain Number 2 Region: 18-52
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 0.000000000589
Family SWIB/MDM2 domain 0.00078
Further Details:      
 
Domain Number 3 Region: 189-237
Classification Level Classification E-value
Superfamily RING/U-box 0.000000226
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018648   Gene: ENSMMUG00000014193   Transcript: ENSMMUT00000019922
Sequence length 243
Comment pep:known chromosome:MMUL_1:11:65799094:65828497:1 gene:ENSMMUG00000014193 transcript:ENSMMUT00000019922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEDYWKCTSC
NEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVN
DSKESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVES
SLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLT
YFP
Download sequence
Identical sequences F7AKP5
ENSMMUP00000018648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]