SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018651 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018651
Domain Number 1 Region: 1-26
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000251
Family Ran binding protein zinc finger-like 0.00053
Further Details:      
 
Domain Number 2 Region: 127-175
Classification Level Classification E-value
Superfamily RING/U-box 0.000000224
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018651   Gene: ENSMMUG00000014193   Transcript: ENSMMUT00000019925
Sequence length 181
Comment pep:known chromosome:MMUL_1:11:65799094:65828497:1 gene:ENSMMUG00000014193 transcript:ENSMMUT00000019925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDS
KESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQDKEESVESSL
PLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYF
P
Download sequence
Identical sequences ENSMMUP00000018651 ENSMMUP00000018653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]