SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018673 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018673
Domain Number 1 Region: 1067-1229,1257-1336
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-39
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 558-785
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.31e-38
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 1384-1635
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-34
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 1-155,257-324
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.53e-34
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018673   Gene: ENSMMUG00000014213   Transcript: ENSMMUT00000019950
Sequence length 1675
Comment pep:known_by_projection chromosome:MMUL_1:20:1150210:1175099:1 gene:ENSMMUG00000014213 transcript:ENSMMUT00000019950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WFEHVSMLVIMLNCVTLGMFRPCEDVECGSERCNILEAFDAFIFAFFAVEMVIKMVALGL
FGQKCYLGDTWNRLDFFIVVAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPRVAPCV
HMLXGHAAMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQ
TEEGEENPFICSSRRDNGMQKCSHIPSRRELRVPCTLGWEAYVQPQAEGVGATRNACINW
NQYYNVCRSGDSNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFI
LLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEEL
LKYVGHIFRKVKRRGLRLYARWQSRWRKKVDPSAVQGQGPGHRQRRAGRHTASVHHLVSR
NVAVGVGPVCPGVSVNVPSMCPNFVCLSVPCPLPSPPAGTLTCELKSCPYCTRALEDPEG
ELSGSESGDSDGRGIYEFTQDIQHGDRRDPMQPPPATDTPGPGSPRRRAQQMAAPGEPGR
LGHLWATFSGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTHALEISNIVFTS
MFALEMLLKLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADGGLSVLRTFRLLRVLKL
VRFLPALRRQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDR
KNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAIL
VEGFQAEGDANRSDTDEDKTSVHFEEDFHKLRELQTTANGLAECTAHSTGRPKAAGGRSV
PGKQTAGQAGVPLPREAARFPLQPGHLSGSGELEGSSFETNSRQYHLQQSRSTGANLRNS
PCAPWGHNGARSSRRKKWSSLGRAPILKRRSLCGARESLMSGEGKGNTEEEAEDGRATPG
PRATPLRRAESLDPRPLRPAPHPPTKCRDCNGQMVALPSEFFLRVDSHREDAAELDDDLE
DSCCFRLHKVLEPYKPQWCRSREAWALYLFSPQKPRFRVSCQKIITHKMFDHVVLVFIFL
NCVTIALERPDIDPGSTERAFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNL
LDGLLVLVSLVDIVVAMASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISS
LRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEGGDTRNISTKAQCRAAHYRWVRRKYN
FDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFV
LNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLERRRRKAQRRPYYADYSPTRRSIHS
LCTSHYLDLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFG
FRRFFKDRWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMA
TGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFS
NFGMAFLTLFRVSTGDNWNGIMKDTLRECTREDKHCLSYLPALSPVYFVTFVLVAQFVLV
NVVVAVLMKHLEESNKEAREDAELDAEIELELAQGPGGARRVDADRPPSPQESPG
Download sequence
Identical sequences ENSMMUP00000018673 9544.ENSMMUP00000018673 ENSMMUP00000018673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]