SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018727 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018727
Domain Number 1 Region: 354-710
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.15e-141
Family Transferrin 0.0000000000141
Further Details:      
 
Domain Number 2 Region: 23-352
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.39e-127
Family Transferrin 0.0000000000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018727   Gene: ENSMMUG00000014261   Transcript: ENSMMUT00000020008
Sequence length 710
Comment pep:known_by_projection chromosome:MMUL_1:2:90062067:90090651:1 gene:ENSMMUG00000014261 transcript:ENSMMUT00000020008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLVFLALLFLGTLGLCLAARRRSVRWCAVSKPEATKCSQWQRNLRRVRGPPVSCIKRAS
PTNCIQAIAANRADAMTLDGGLMYEAGLAPYKLRPVAAEVYGTEEKPRTHYYAVAVVKKG
GRFQLNELQGLKSCHTGLNRTAGWIVPIGMLRPFLNWTGPPEAIEAAVARFFSASCVPGA
DKGQFPNLCRLCVGTGENKCAFSSQEPYFGYSGAFKCLRDGAGDVAFIRESTVFEDLSDP
AERDNYELLCPDNTRKPVDKFKECHLARVPSHAVVARSVNGKEDAIWELLRQAQEKFGKD
KSPEFQLFGSPRGQKDLLFKDSAIGFSRVPLRIDSGLYLGSGYLTAIQNLRKSEEEVAAR
RARVEWCAVGQQELEKCDQWISSQRGHMGPNEAGTPGGSALSLQKGEADAMSLDGGYVYT
AGKCGLVPVLAENYKPQQSSGPDPNCVDRPVEGYLAVAVVRNSDAGLTWNSLKGKKSCHT
AVDRTAGWNIPIGLLFNQTGSCKFDEYFSQSCAPGADPRSNLCALCIGNEQGEDKCVPNN
NERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGKNTDAWAKDLKLNDFELLCLDGTRK
PVTEARSCHLAMAPNHAVVSRTEKVERLKQVLFDQQAKFGKNGSDCPGTFCLFQSKTKNL
LFNDNTECLARLHGKTTYEKYLGPQYVTAITNLKKCSSSPLLEACAFLQK
Download sequence
Identical sequences ENSMMUP00000018727 ENSMMUP00000018727 9544.ENSMMUP00000018727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]