SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018955 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018955
Domain Number 1 Region: 300-562
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.98e-86
Family Eukaryotic proteases 0.00000000062
Further Details:      
 
Domain Number 2 Region: 107-212
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-33
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 3 Region: 215-303
Classification Level Classification E-value
Superfamily Kringle-like 5.83e-32
Family Kringle modules 0.00000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018955   Gene: ENSMMUG00000014432   Transcript: ENSMMUT00000020250
Sequence length 564
Comment pep:known_by_projection chromosome:MMUL_1:8:42752750:42785045:-1 gene:ENSMMUG00000014432 transcript:ENSMMUT00000020250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAMKRGLCCVLLLCGAVFASPSQEIHARFRRGARSYQVPLQHDSTEMPVSAPFSHQLRP
RGGQDENSICRMRNSICSVLHTAGLECCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKH
CEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNY
CRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYLGNGLAYRGTHSLTASGASCLP
WNSMMLIGKVYTAQNPNAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCST
CGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRLPGERFLCGGILISSCWILSAAHC
FQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSH
CAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTS
QHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNGGRMTLVGIISWGLGCG
QKDVPGVYTKVTNYLDWIQDNMQP
Download sequence
Identical sequences 9544.ENSMMUP00000018955 ENSMMUP00000018955 ENSMMUP00000018955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]