SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018956 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018956
Domain Number 1 Region: 252-514
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.55e-86
Family Eukaryotic proteases 0.00000000062
Further Details:      
 
Domain Number 2 Region: 59-164
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-33
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 3 Region: 167-255
Classification Level Classification E-value
Superfamily Kringle-like 6.51e-32
Family Kringle modules 0.00000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018956   Gene: ENSMMUG00000014432   Transcript: ENSMMUT00000020251
Sequence length 516
Comment pep:known_by_projection chromosome:MMUL_1:8:42752750:42785045:-1 gene:ENSMMUG00000014432 transcript:ENSMMUT00000020251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAMKRGLCCVLLLCGAVFASPSQEIHARFRRGARSYQGCSEPRCFNGGTCQQALYFSDF
VCQCPEGFAGKHCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRP
DAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYLGNGLAYRGT
HSLTASGASCLPWNSMMLIGKVYTAQNPNAQALGLGKHNYCRNPDGDAKPWCHVLKNRRL
TWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRLPGERFLCGGIL
ISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDND
IALLQLKSDSSHCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEA
HVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNGGRMT
LVGIISWGLGCGQKDVPGVYTKVTNYLDWIQDNMQP
Download sequence
Identical sequences F7BHU2
ENSMMUP00000018956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]