SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019042 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019042
Domain Number 1 Region: 475-707
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1474-1724
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-32
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 3 Region: 1149-1311,1348-1425
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.28e-32
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 4 Region: 89-246,288-358
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.84e-30
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019042   Gene: ENSMMUG00000014498   Transcript: ENSMMUT00000020345
Sequence length 2297
Comment pep:known_by_projection chromosome:MMUL_1:1:188894423:189215500:-1 gene:ENSMMUG00000014498 transcript:ENSMMUT00000020345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQAAAYKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIDRRYSTKFLDSPNLVYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGVSYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRKHMQMSSQEALNREEAPSMNPLNPLSSLNPLNTHSSLYRRPRAIEGLALGLALE
KFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAGGGE
AVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAMPTEGEKDPELR
GNHGAKEPTIQEERAQDLRRTNSLMVSRGSGLAGGLDEANAPLVLPHPELEVGKDMVPTE
QEPEGSSEQALLGDVQLDMGRVISQSEPDLSCITANTDKATTESTSVTVAIPDVGPLVDS
TVVHISNKTDGEASPLKEAEIREDDEEVENKKQKKEKRETGKAMVPHSSMFIFSTTNPIR
RACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVI
KMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALAQTLVTNKGRDIKTIKSLRVLRVL
RPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSK
DTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVD
VTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNE
RACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAP
CTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSK
LVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAI
IGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTT
APSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDE
FVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTV
HFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDL
TVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQ
DPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQPSNHGI
YLPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSS
ENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSE
ERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSRRQLPPIP
PKPRPLLSYSSLIRHVGSISPPADGSEEGSPLTSQALENNNTCLTESSNSPHPRQGQHAS
PQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHY
RRRRRGGPGPGMMCGAV
Download sequence
Identical sequences ENSMMUP00000019042 9544.ENSMMUP00000019042 ENSMMUP00000004737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]