SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019059 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019059
Domain Number 1 Region: 133-381
Classification Level Classification E-value
Superfamily vWA-like 1.07e-82
Family Integrin A (or I) domain 0.0000000194
Further Details:      
 
Domain Number 2 Region: 377-466
Classification Level Classification E-value
Superfamily Integrin domains 2.62e-30
Family Integrin domains 0.0001
Further Details:      
 
Domain Number 3 Region: 633-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.94e-19
Family Integrin beta tail domain 0.00034
Further Details:      
 
Domain Number 4 Region: 26-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000251
Family Plexin repeat 0.00072
Further Details:      
 
Domain Number 5 Region: 592-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family Integrin beta EGF-like domains 0.0031
Further Details:      
 
Domain Number 6 Region: 549-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Domain Number 7 Region: 87-156
Classification Level Classification E-value
Superfamily Integrin domains 0.00000335
Family Integrin domains 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019059
Domain Number - Region: 518-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 474-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0614
Family Integrin beta EGF-like domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019059   Gene: ENSMMUG00000014516   Transcript: ENSMMUT00000020363
Sequence length 799
Comment pep:known chromosome:MMUL_1:2:44760762:44883196:-1 gene:ENSMMUG00000014516 transcript:ENSMMUT00000020363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAPAPLYACLLGLCALLPGLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSI
TSRCDLRANLVRNGCGGEIESPASSFHILRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDTIRNLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TASFEVSVEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCSGSG
TYVCGLCECSPGYLGTRCECQDGENHSVYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGKDGQ
ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYTELPSGKSNLTVLREPECGNTPNA
MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFTFNKFNKSYNGTVD
Download sequence
Identical sequences A0A2K5UEB4 A0A2K6DXI5 F7GE04
ENSMMUP00000019059 ENSMMUP00000019059 NP_001253135.1.72884 XP_005547990.1.63531 XP_011720356.1.29376 9544.ENSMMUP00000019059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]