SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019125 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019125
Domain Number 1 Region: 341-434
Classification Level Classification E-value
Superfamily Kringle-like 9.67e-34
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 2 Region: 164-248
Classification Level Classification E-value
Superfamily Kringle-like 2.27e-33
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 3 Region: 255-337
Classification Level Classification E-value
Superfamily Kringle-like 1.06e-30
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 4 Region: 80-163
Classification Level Classification E-value
Superfamily Kringle-like 2.2e-29
Family Kringle modules 0.00022
Further Details:      
 
Domain Number 5 Region: 434-565
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.93e-24
Family Eukaryotic proteases 0.00056
Further Details:      
 
Domain Number 6 Region: 18-80
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000000000549
Family Hairpin loop containing domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019125   Gene: ENSMMUG00000014547   Transcript: ENSMMUT00000020432
Sequence length 566
Comment pep:known chromosome:MMUL_1:2:86732619:86737298:1 gene:ENSMMUG00000014547 transcript:ENSMMUT00000020432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRCSGAQSYLLHAVVPEPWQEDVSDAEECAGRCGPLLDCQAFHYNVSSHGCQLLPWTQ
HSPHTRLRHSGRCDLFQKKYIRTCIMDNGVGYRGTVATTVDGLPCQAWSHKFPNDHRYTP
TLRNGLEDNFCRNPDGDPGGPWCYTINPAVRFQSCGIKSCREAACVWCNGEDYRGAVDRT
ESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYCRNPDGSERPWCYTTDPQLEREFCDLP
RCGSEAQPRHEATTVSCFRGKGEGYRGTANTTTAGVPCQRWDAQIPHQHRFTPEKYACKD
LRENFCRNPDGSEAPWCFTLRPGMRVAFCYQIRRCADDVRPQDCYHGTGEQYRGTVSKTR
KGVQCQRWSAETPHKPQFTFTPEPHAQLEENFCRNPDGDSHGPWCYTMDPGTPFDYCALR
RCADDQPPSILDPPDQVQFEKCGKRVDRLDQRRSKLRVVGGHPGNSPWTVSLRNRQGQHF
CGGSLVKEQWILTARQCFSSCHMPLMGYEVWLGTLFQNPQHGEPGLQRVPVAKMVCGPSG
SQLVLLKLERSVTLNQRVALICLPPE
Download sequence
Identical sequences ENSMMUP00000019125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]