SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019178 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019178
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily UBC-like 3.91e-38
Family UEV domain 0.000000521
Further Details:      
 
Domain Number 2 Region: 316-376
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.66e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019178
Domain Number - Region: 229-306
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0045
Family FCH domain 0.046
Further Details:      
 
Domain Number - Region: 153-204
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0602
Family beta-sandwich domain of Sec23/24 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019178   Gene: ENSMMUG00000014613   Transcript: ENSMMUT00000020492
Sequence length 383
Comment pep:known chromosome:MMUL_1:14:53342168:53392068:1 gene:ENSMMUG00000014613 transcript:ENSMMUT00000020492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHV
SINEMGLLFVMYILFGSLPIQALYIYNVKKLFLASYMPGMPGGISPYPSGYPPNPSGYPG
CPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMD
RAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMEN
QSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLS
RKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences ENSMMUP00000019178 9544.ENSMMUP00000019178 ENSMMUP00000019178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]