SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019231 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019231
Domain Number 1 Region: 25-110
Classification Level Classification E-value
Superfamily Immunoglobulin 3.28e-27
Family I set domains 0.0000206
Further Details:      
 
Domain Number 2 Region: 108-206
Classification Level Classification E-value
Superfamily Immunoglobulin 5.04e-18
Family C2 set domains 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019231   Gene: ENSMMUG00000014656   Transcript: ENSMMUT00000020550
Sequence length 275
Comment pep:known chromosome:MMUL_1:16:59557050:59576646:-1 gene:ENSMMUG00000014656 transcript:ENSMMUT00000020550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFGFGTLTVALFALVCCSGSDEKAFEVHMRLEKLIVKPKESFEVNCSTTCNQPEVGGL
ETSLNKILLLEQTQWKHYLISNISHDTVLWCHFTCSGKQKSMSSNVSVYQPPRQVFLTLQ
PTWVAVGKSFTIECRVPAVEPLDSLTLSLLRGSETLHSQTFGKAAPALQEATATFSSMAH
REDGHHNFSCLAVLDLMSRGGEVFCTHSAPKMLEIYEPVPDSQMVIIVTVVSVLLFLFVT
SVLLCFIFSQHWRQRRMGTYGVRAAWRRLPQAFRP
Download sequence
Identical sequences A0A1D5RJR6 G8F5R4
ENSMMUP00000019231 9544.ENSMMUP00000019231 ENSMMUP00000019231 NP_001182318.1.72884 XP_005584746.1.63531 XP_005584747.1.63531 XP_014975532.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]