SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019396 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019396
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily Immunoglobulin 8.78e-31
Family V set domains (antibody variable domain-like) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019396   Gene: ENSMMUG00000031719   Transcript: ENSMMUT00000020727
Sequence length 99
Comment pep:novel scaffold:MMUL_1:1099214739645:13449:14231:-1 gene:ENSMMUG00000031719 transcript:ENSMMUT00000020727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVLTQPPSASASLGASVKLTCTLSSEHSNYFILWYQQRPGRSPRYIMKVNSDGTQSKGDG
IPDRFLGSSSGADRYLTISNLQSDDEAEYYCVSSWNSDL
Download sequence
Identical sequences 9544.ENSMMUP00000019396 ENSMMUP00000019396 ENSMMUP00000019396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]