SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019469 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019469
Domain Number 1 Region: 1593-1784
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.15e-40
Family Laminin G-like module 0.00064
Further Details:      
 
Domain Number 2 Region: 1847-2049
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.66e-38
Family Laminin G-like module 0.00061
Further Details:      
 
Domain Number 3 Region: 1322-1531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.3e-33
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 4 Region: 1256-1344
Classification Level Classification E-value
Superfamily Immunoglobulin 4.53e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 982-1071
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 6 Region: 895-987
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-19
Family I set domains 0.0077
Further Details:      
 
Domain Number 7 Region: 1179-1262
Classification Level Classification E-value
Superfamily Immunoglobulin 2.53e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 792-886
Classification Level Classification E-value
Superfamily Immunoglobulin 7.74e-17
Family I set domains 0.035
Further Details:      
 
Domain Number 9 Region: 706-801
Classification Level Classification E-value
Superfamily Immunoglobulin 7.97e-17
Family I set domains 0.031
Further Details:      
 
Domain Number 10 Region: 119-206
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-16
Family I set domains 0.05
Further Details:      
 
Domain Number 11 Region: 312-400
Classification Level Classification E-value
Superfamily Immunoglobulin 3.47e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 12 Region: 221-305
Classification Level Classification E-value
Superfamily Immunoglobulin 3.76e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 13 Region: 414-500
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000115
Family I set domains 0.054
Further Details:      
 
Domain Number 14 Region: 608-693
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000195
Family I set domains 0.072
Further Details:      
 
Domain Number 15 Region: 1084-1175
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000484
Family I set domains 0.021
Further Details:      
 
Domain Number 16 Region: 510-596
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000053
Family I set domains 0.035
Further Details:      
 
Domain Number 17 Region: 27-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000403
Family V set domains (antibody variable domain-like) 0.094
Further Details:      
 
Domain Number 18 Region: 1525-1566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000119
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1789-1832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000664
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019469   Gene: ENSMMUG00000014828   Transcript: ENSMMUT00000020806
Sequence length 2075
Comment pep:known chromosome:MMUL_1:1:24437648:24470544:-1 gene:ENSMMUG00000014828 transcript:ENSMMUT00000020806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASITVTVTGTQGANLAYPAGSTQPVRVEPSSSQVAEGQTLDLNCVVPGQSHAQVTWHK
RGGSLPVRHQTHGSLLRLYQVSPADSGEYVCRVAGSSVPLEASVLVTIEPAGSVPALGVT
PTVRIESSSSHVAEGQTLDLNCLVAGQAHAQVTWHKRGGSLPARHQVHGSRLRLLQVTPA
DSGEYVCRVVGSSGTQEASVLVTIQQRLSGSHSQGVAYPVRIESSSASLANGHTLDLNCL
VASQAPHTITWYKRGGSLPSRHQIVGSRLRIPQVTPADSGEYVCHVSNGAGSRETSLIVT
IQGSGSSHVPSVSPPIRIESSSPTVVEGQTLDLNCVVARQPQAIITWYKRGGSLPSRHQT
HGSHLRLHQMSVADSGEYVCRANNNIDALEASIVISVSPRAGSPSAPGSSMPIRIESSSS
HVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPSHHQAHGSRLRLHQVSPADSGEYVCRVM
GSSGPLEASVLVTIEASGSSAVHVPAPGGAPPIRIETSSSRVAEGQTLDLKCVVPGQAHA
QVTWHKRGGNLPARHQVHGPLLRLNQVSPADSGEYSCQVTGSSGTLEASVLVTIEPSSPG
PIPAPGLAQPIYIEASSSHVTEGQTLDLNCVVPGQAHAQVTWYKRGGSLPARHQTHGSQL
RLHQVSPADSGEYVCRAAGGPGPEQEASFTVTVPPSEGSSYRLRSPVISIDPPSSTVQQG
QDASFKCLIHDGAVPISLEWKTRNQELEDNVHISPNGSIITIVGTRPSNHGTYRCVASNA
YGVAQSVVNLSVHGPPTVSVLPEGPVWVKVGKAVTLECVSAGEPRSSARWTRISSAPAKL
EQRTYGLMDSRAVLQISSAKPSDAGTYVCLAQNALGTAQKQVEVIVDTGAMAPGAPQVQA
EEAELTVEAGHTATLRCSATGSPTPTIHWSKLRSPLPWQHRLEGDTLIIPRVAQQDSGQY
ICNATSPAGHAEATIILHVESPPYATTVPEHASVQAGETVQLQCLAHGTPPLTFQWSRVG
SSLPGRATARNELLHFERAAPEDSGRYRCRVTNKVGSAEAFAQLLVQGPPGSLPATSIPA
GSTPTVQVTPQLETKSIGASVEFHCAVPSDRGTQLRWFKEGGQLPPGHSVQDGVLRIQNL
DQSCQGTYICQAHGPWGQAQASAQLVVQALPSVLINIRTSVQTVVVGHAVEFECLALGDP
KPQVTWSKVGGHLRPGIVQSGGVVRIAHVELADAGQYRCTATNAAGTTQSHVLLLVQALP
QISMPQEVRVPAGSAAVFPCIASGYPTPDISWSKLDGSLPPDSRLENNMLTLPSVQPQDA
GTYVCTATNRQGKVKAFAHLQVPERVVPYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDS
ADGMLLYNGQKRVPGSPTNLANRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLALGH
FHTVTLLRSLTQGSLIVGDLAPVNGTSQGKFQGLDLNEELYLGGYPDYGAIPKVGLSSGF
IGCVRDLRIQGEEIIFHDLNLTAHGISHCPTCRDRPCQNGGQCHDSESSSYMCVCPAGFT
GSRCEHSQALHCHPEACGPDATCVNRPDGRGYTCRCHLGRSGLRCEEGVTVTTPSLSGAG
SYLALPALTNTHHELRLDVEFKPLAPDGVLLFSGGKSGPVEDFVSLAMVGGHLEFRYELG
SGLAVLRSAEPLALGRWHRVSAERLNKDGSLRVNGGRPVLRSSPGKSQGLNLHTLLYLGG
VEPSVPLSPATNMSAHFRGCVGEVSVNGKRLDLTYSFLGSQGIGQCYDSSPCERQPCQHG
ATCMPAGEYEFQCLCRDGFKGDLCEHEENPCQLREPCLHGGTCQGTRCLCLPGFSGPRCQ
QGSGHGIAESDWHLEGSGGNDAPGQYGAYFHDDGFLAFPGRIFSRSLPEVPETIELEVRT
STANGLLLWQGVEVGEAGRGKDFISLGLQDGHLVFRYQLGSGEARLVSEDPINDGEWHRV
TALREGRRGSIQVDGEELVSGRSPGPNVAVNAKGSVYIGGAPDVTILTGGRFSSGITGCV
KNLVLHSARPGAPPPQPLDLQHRAQAGANTRPCPS
Download sequence
Identical sequences ENSMMUP00000019469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]