SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019474 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019474
Domain Number 1 Region: 46-240
Classification Level Classification E-value
Superfamily Formyltransferase 6.8e-41
Family Formyltransferase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019474   Gene: ENSMMUG00000014834   Transcript: ENSMMUT00000020811
Sequence length 383
Comment pep:known_by_projection chromosome:MMUL_1:7:43474589:43502724:-1 gene:ENSMMUG00000014834 transcript:ENSMMUT00000020811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLVRRCWGPPLAHGAGRGRPSPQWRALARLGWEDSRVREKPPWRVLFFGTDQFAREAL
RALHAARENQEEELIDKLEVVTIPSLSPRGLPVKQYAVQSQLPIYEWPDVGSGEYDVGVV
ASFGRLLSEALILKFPYGILNVHPSCLPRWRGPAPVIHTVLHGDTVTGVTIMQIRPKRFD
VGPILKQETIPVPPKSTAKELEAVLSRLGANMLISVLKNLPESLSNGRQQPTEGATYAPK
ISAGTSCVKWEEQTSEQIFRLYRAIGNIIPLQTLWMGNTIKLLDLVEVNSSVLAANVETV
FTVVCLEICLFYHMSQLLKIRILLDSWIGVRSVMLKKTLTATDFYNGYLHPWYQKNSQAQ
PSQCRFQTLRLPTKKKQNKTVTM
Download sequence
Identical sequences ENSMMUP00000019474 ENSMMUP00000019474 9544.ENSMMUP00000019474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]