SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019482 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019482
Domain Number 1 Region: 316-405
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.08e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 142-194
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000644
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 37-96
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000851
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019482   Gene: ENSMMUG00000014839   Transcript: ENSMMUT00000020820
Sequence length 913
Comment pep:known chromosome:MMUL_1:7:96008325:96745464:1 gene:ENSMMUG00000014839 transcript:ENSMMUT00000020820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAARSRRGKENFEFYELAK
LLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEGPPPNTSVKVIGAQRRR
SPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGSSVFD
YVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSETPEPVESTSPSLLTTD
NTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVVVAH
ALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAEDVE
GIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNYLLSNP
EYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNENSKSDEKGNQSENSEDP
EPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAGEDGFGALGPMQIK
VERYVESESDLRLQNCESLTSDSAKDSDSAGETGAQASSKHQKRKKRRKRQKGGSASRRR
LSSASSPGGLDAGLVEPPRLLSSPNSASVLKIKTEISEPINFDNDSSIWNYPPNREISRN
ESPYSMTKPPSSEHFPSPQGGGGGGGGSGGLHVAIPDSVLTPPGADGAAARKTQFGASAT
TALAPVASDPLSPPLSASPRDKHPGNGGGGGGGGGGGPSASNSLLYTGDLEALQRLQAGN
VVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQGNLLPNAHAVNFVDVNSPG
FGLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPAGNVFTTAEGLFSTLPFPVYSN
GIHAAQTLERKED
Download sequence
Identical sequences 9544.ENSMMUP00000019482 ENSMMUP00000019482 ENSMMUP00000019480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]