SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019493 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019493
Domain Number 1 Region: 10-55
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000155
Family C-type lectin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019493   Gene: ENSMMUG00000014848   Transcript: ENSMMUT00000020832
Sequence length 134
Comment pep:novel scaffold:MMUL_1:1099214732204:21613:30350:-1 gene:ENSMMUG00000014848 transcript:ENSMMUT00000020832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRSMRLLLLLNCLAKIGVLGDVIRRPSCAPGWFYHKPNCYGYFRKLRNWSDAEVRNLP
PAWPGLSRAKDQPEPQISFDSGSSVLPGHYEEKPLWLVKWREEGCVFNSFNSVSIAEAGA
VCHTLDGLQAHTDT
Download sequence
Identical sequences ENSMMUP00000019493 ENSMMUP00000019493 9544.ENSMMUP00000019493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]