SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019503 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019503
Domain Number 1 Region: 87-161
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 0.0000000000000602
Family Ribosome-binding factor A, RbfA 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019503   Gene: ENSMMUG00000014855   Transcript: ENSMMUT00000020844
Sequence length 242
Comment pep:known_by_projection chromosome:MMUL_1:18:73287821:73298930:1 gene:ENSMMUG00000014855 transcript:ENSMMUT00000020844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAVAGGLWGSRAGLRGLLRSRDAALLPDCARGVHGSAVFCKNWLKKFASKTKKKFWYEG
PSLGSHLTYKPSKLEFLMKTTSKKTRKEDHVRVRALNGLLYKALTDLLCTPEVSQELYDL
NVELSKVSLTPDFSACRVYWKTTLSAEQNAHMEAVLQRSAASMSLTSYWQSQTLDPGMKE
TTLYKMISGTPMPRNPVAPQSRPRAPACVVSIMRRSTSRLWSTKGGKIKGSGAWCGRGMR
LS
Download sequence
Identical sequences F6U4J0
ENSMMUP00000019503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]