SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019513 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019513
Domain Number 1 Region: 49-267
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.56e-76
Family Phosphate binding protein-like 0.0000038
Further Details:      
 
Domain Number 2 Region: 269-327,361-382
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 2.62e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019513   Gene: ENSMMUG00000014866   Transcript: ENSMMUT00000020856
Sequence length 391
Comment pep:known chromosome:MMUL_1:14:117491374:117499729:1 gene:ENSMMUG00000014866 transcript:ENSMMUT00000020856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGNAAATAVSAEPVTSTLWASGRAVQQLAPGCHPQSLLEENSPKMRVIRVGTRKSQL
ARIQTDSVVATLKALYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEV
DLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRR
AAQLQRKFSHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEE
CMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTA
MKDGQLYLTGGVWSLDGSDSIQDTMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLA
AQNLGISLANLLLSKGAKNILDVARQLNDAH
Download sequence
Identical sequences G7NCE4 G7PP48
9544.ENSMMUP00000019513 XP_011730557.1.29376 XP_014971374.1.72884 XP_015291310.1.63531 ENSMMUP00000036652 ENSMMUP00000019513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]