SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019685 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019685
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.012
Further Details:      
 
Domain Number 2 Region: 245-347
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000017
Family Scavenger receptor cysteine-rich (SRCR) domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019685
Domain Number - Region: 137-245
Classification Level Classification E-value
Superfamily SRCR-like 0.00929
Family Hepsin, N-terminal domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019685   Gene: ENSMMUG00000015018   Transcript: ENSMMUT00000021055
Sequence length 469
Comment pep:known_by_projection chromosome:MMUL_1:14:12995524:13003428:-1 gene:ENSMMUG00000015018 transcript:ENSMMUT00000021055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPL
SLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTT
PEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQC
GSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFRKIKPRNSGQVLALL
CSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNS
YQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNPAGPAAGTVASIILA
LVLLGVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHVENPTA
SHVDNEYSQPPRNSRLSAYPALEGALHRSSTQPDNSSDSDYDLHGAQRL
Download sequence
Identical sequences ENSMMUP00000019685 9544.ENSMMUP00000019685 ENSMMUP00000019685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]